Anti FBXL22 pAb (ATL-HPA054627)

Atlas Antibodies

SKU: ATL-HPA054627-25

• 

Protein Description: F-box and leucine-rich repeat protein 22
Gene Name: FBXL22
Alternative Gene Name: Fbl22, FLJ39626
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059934: 37%, ENSRNOG00000003357: 36%
Entrez Gene ID: 283807
Uniprot ID: Q6P050
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ
• Gene Sequence: ERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ
• Gene ID - Mouse: ENSMUSG00000059934
• Gene ID - Rat: ENSRNOG00000003357
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.