Anti FBXL14 pAb (ATL-HPA053889)

Atlas Antibodies

SKU: ATL-HPA053889-25

• 
• 
• 

Protein Description: F-box and leucine-rich repeat protein 14
Gene Name: FBXL14
Alternative Gene Name: Fbl14, MGC40195
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030019: 78%, ENSRNOG00000025497: 33%
Entrez Gene ID: 144699
Uniprot ID: Q8N1E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSS
• Gene Sequence: TLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSS
• Gene ID - Mouse: ENSMUSG00000030019
• Gene ID - Rat: ENSRNOG00000025497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.