Anti FBXL13 pAb (ATL-HPA057232)

Atlas Antibodies

SKU:
ATL-HPA057232-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferous ducts and in Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: F-box and leucine-rich repeat protein 13
Gene Name: FBXL13
Alternative Gene Name: Fbl13, MGC21636
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048520: 74%, ENSRNOG00000043035: 67%
Entrez Gene ID: 222235
Uniprot ID: Q8NEE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCV
Gene Sequence GNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCV
Gene ID - Mouse ENSMUSG00000048520
Gene ID - Rat ENSRNOG00000043035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FBXL13 pAb (ATL-HPA057232)
Datasheet Anti FBXL13 pAb (ATL-HPA057232) Datasheet (External Link)
Vendor Page Anti FBXL13 pAb (ATL-HPA057232) at Atlas Antibodies

Documents & Links for Anti FBXL13 pAb (ATL-HPA057232)
Datasheet Anti FBXL13 pAb (ATL-HPA057232) Datasheet (External Link)
Vendor Page Anti FBXL13 pAb (ATL-HPA057232)