Anti FBLIM1 pAb (ATL-HPA072750)

Atlas Antibodies

SKU:
ATL-HPA072750-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center & cell junctions.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: filamin binding LIM protein 1
Gene Name: FBLIM1
Alternative Gene Name: CAL, FBLP-1, migfilin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006219: 63%, ENSRNOG00000011774: 67%
Entrez Gene ID: 54751
Uniprot ID: Q8WUP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGE
Gene Sequence SKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGE
Gene ID - Mouse ENSMUSG00000006219
Gene ID - Rat ENSRNOG00000011774
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FBLIM1 pAb (ATL-HPA072750)
Datasheet Anti FBLIM1 pAb (ATL-HPA072750) Datasheet (External Link)
Vendor Page Anti FBLIM1 pAb (ATL-HPA072750) at Atlas Antibodies

Documents & Links for Anti FBLIM1 pAb (ATL-HPA072750)
Datasheet Anti FBLIM1 pAb (ATL-HPA072750) Datasheet (External Link)
Vendor Page Anti FBLIM1 pAb (ATL-HPA072750)