Anti FBLIM1 pAb (ATL-HPA072750)
Atlas Antibodies
- SKU:
- ATL-HPA072750-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: filamin binding LIM protein 1
Gene Name: FBLIM1
Alternative Gene Name: CAL, FBLP-1, migfilin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006219: 63%, ENSRNOG00000011774: 67%
Entrez Gene ID: 54751
Uniprot ID: Q8WUP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FBLIM1
Alternative Gene Name: CAL, FBLP-1, migfilin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006219: 63%, ENSRNOG00000011774: 67%
Entrez Gene ID: 54751
Uniprot ID: Q8WUP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGE |
Gene Sequence | SKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGE |
Gene ID - Mouse | ENSMUSG00000006219 |
Gene ID - Rat | ENSRNOG00000011774 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FBLIM1 pAb (ATL-HPA072750) | |
Datasheet | Anti FBLIM1 pAb (ATL-HPA072750) Datasheet (External Link) |
Vendor Page | Anti FBLIM1 pAb (ATL-HPA072750) at Atlas Antibodies |
Documents & Links for Anti FBLIM1 pAb (ATL-HPA072750) | |
Datasheet | Anti FBLIM1 pAb (ATL-HPA072750) Datasheet (External Link) |
Vendor Page | Anti FBLIM1 pAb (ATL-HPA072750) |