Anti FAT4 pAb (ATL-HPA052819)

Atlas Antibodies

SKU: ATL-HPA052819-25

• 
• 

Protein Description: FAT atypical cadherin 4
Gene Name: FAT4
Alternative Gene Name: CDHF14, CDHR11, FAT-J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046743: 97%, ENSRNOG00000028335: 97%
Entrez Gene ID: 79633
Uniprot ID: Q6V0I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
• Gene Sequence: FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
• Gene ID - Mouse: ENSMUSG00000046743
• Gene ID - Rat: ENSRNOG00000028335
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAT4 pAb (ATL-HPA052819) – 1 Found

Ma, Liangang; Cui, Jianxin; Xi, Hongqing; Bian, Shibo; Wei, Bo; Chen, Lin. Fat4 suppression induces Yap translocation accounting for the promoted proliferation and migration of gastric cancer cells. Cancer Biology & Therapy. 17(1):36-47.