Protein Description: FAST kinase domains 2
Gene Name: FASTKD2
Alternative Gene Name: KIAA0971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025962: 76%, ENSRNOG00000023923: 76%
Entrez Gene ID: 22868
Uniprot ID: Q9NYY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FASTKD2
Alternative Gene Name: KIAA0971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025962: 76%, ENSRNOG00000023923: 76%
Entrez Gene ID: 22868
Uniprot ID: Q9NYY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QQVWKIEDVFTLQVVMKCIGKDAPIALKRKLEMKALRELDRFSVLNSQHMFEVLAAMNHRSLILLDECSKVVLDNIHGCPLRIMINILQSCKDLQY |
| Documents & Links for Anti FASTKD2 pAb (ATL-HPA067191) | |
| Datasheet | Anti FASTKD2 pAb (ATL-HPA067191) Datasheet (External Link) |
| Vendor Page | Anti FASTKD2 pAb (ATL-HPA067191) at Atlas |
| Documents & Links for Anti FASTKD2 pAb (ATL-HPA067191) | |
| Datasheet | Anti FASTKD2 pAb (ATL-HPA067191) Datasheet (External Link) |
| Vendor Page | Anti FASTKD2 pAb (ATL-HPA067191) |