Anti FANCG pAb (ATL-HPA045335)

Atlas Antibodies

SKU: ATL-HPA045335-25

• 

Protein Description: Fanconi anemia, complementation group G
Gene Name: FANCG
Alternative Gene Name: FAG, XRCC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028453: 72%, ENSRNOG00000057945: 71%
Entrez Gene ID: 2189
Uniprot ID: O15287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMG
• Gene Sequence: DSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLLLKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLCPRPVLVQVYTALGSCHRKMG
• Gene ID - Mouse: ENSMUSG00000028453
• Gene ID - Rat: ENSRNOG00000057945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.