Anti FAM84B pAb (ATL-HPA062115)
Atlas Antibodies
- SKU:
- ATL-HPA062115-25
- Shipping:
- Calculated at Checkout
$395.00
Product Description
Protein Description: family with sequence similarity 84, member B
Gene Name: FAM84B
Alternative Gene Name: BCMP101, NSE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072568: 91%, ENSRNOG00000004744: 89%
Entrez Gene ID: 157638
Uniprot ID: Q96KN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM84B
Alternative Gene Name: BCMP101, NSE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072568: 91%, ENSRNOG00000004744: 89%
Entrez Gene ID: 157638
Uniprot ID: Q96KN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQPQPYD |
Gene Sequence | MGNQVEKLTHLSYKEVPTADPTGVDRDDGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQPQPYD |
Gene ID - Mouse | ENSMUSG00000072568 |
Gene ID - Rat | ENSRNOG00000004744 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM84B pAb (ATL-HPA062115) | |
Datasheet | Anti FAM84B pAb (ATL-HPA062115) Datasheet (External Link) |
Vendor Page | Anti FAM84B pAb (ATL-HPA062115) at Atlas Antibodies |
Documents & Links for Anti FAM84B pAb (ATL-HPA062115) | |
Datasheet | Anti FAM84B pAb (ATL-HPA062115) Datasheet (External Link) |
Vendor Page | Anti FAM84B pAb (ATL-HPA062115) |