Anti FAM84B pAb (ATL-HPA050782)

Atlas Antibodies

SKU: ATL-HPA050782-25

• 
• 

Protein Description: family with sequence similarity 84, member B
Gene Name: FAM84B
Alternative Gene Name: BCMP101, NSE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072568: 98%, ENSRNOG00000004744: 98%
Entrez Gene ID: 157638
Uniprot ID: Q96KN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNFQVVHLHRLEVINSFLTDASQ
• Gene Sequence: EVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNFQVVHLHRLEVINSFLTDASQ
• Gene ID - Mouse: ENSMUSG00000072568
• Gene ID - Rat: ENSRNOG00000004744
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.