Anti FAM83F pAb (ATL-HPA051207 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051207-100
  • Immunohistochemistry analysis in human small intestine and liver tissues using HPA051207 antibody. Corresponding FAM83F RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM83F over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408690).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 83, member F
Gene Name: FAM83F
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022408: 74%, ENSRNOG00000018330: 71%
Entrez Gene ID: 113828
Uniprot ID: Q8NEG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYALVSGCRHPPGEMMRWAARQQREAGGNPEGQEEGASGGESAWRLESFLKDLVTVEQVLPPVEPIPLGELSQKDGRMVSHMHR
Gene Sequence KYALVSGCRHPPGEMMRWAARQQREAGGNPEGQEEGASGGESAWRLESFLKDLVTVEQVLPPVEPIPLGELSQKDGRMVSHMHR
Gene ID - Mouse ENSMUSG00000022408
Gene ID - Rat ENSRNOG00000018330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM83F pAb (ATL-HPA051207 w/enhanced validation)
Datasheet Anti FAM83F pAb (ATL-HPA051207 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM83F pAb (ATL-HPA051207 w/enhanced validation)