Anti FAM83E pAb (ATL-HPA049305)

Atlas Antibodies

SKU: ATL-HPA049305-25

• 

Protein Description: family with sequence similarity 83, member E
Gene Name: FAM83E
Alternative Gene Name: FLJ20200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054161: 79%, ENSRNOG00000021039: 78%
Entrez Gene ID: 54854
Uniprot ID: Q2M2I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPVYLLLDRQQLPAFLELAQQLGVNPWNTENVDVRVVRGCSFQSRWRRQVSGTVREKFVLLDGERVISGSYS
• Gene Sequence: VPVYLLLDRQQLPAFLELAQQLGVNPWNTENVDVRVVRGCSFQSRWRRQVSGTVREKFVLLDGERVISGSYS
• Gene ID - Mouse: ENSMUSG00000054161
• Gene ID - Rat: ENSRNOG00000021039
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.