Protein Description: family with sequence similarity 76, member A
Gene Name: FAM76A
Alternative Gene Name: MGC34648
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028878: 67%, ENSRNOG00000011254: 67%
Entrez Gene ID: 199870
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM76A
Alternative Gene Name: MGC34648
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028878: 67%, ENSRNOG00000011254: 67%
Entrez Gene ID: 199870
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QMRAKMNQMEKTHKEVTEQLQVTDSAYFMC |
Documents & Links for Anti FAM76A pAb (ATL-HPA077897) | |
Datasheet | Anti FAM76A pAb (ATL-HPA077897) Datasheet (External Link) |
Vendor Page | Anti FAM76A pAb (ATL-HPA077897) at Atlas |
Documents & Links for Anti FAM76A pAb (ATL-HPA077897) | |
Datasheet | Anti FAM76A pAb (ATL-HPA077897) Datasheet (External Link) |
Vendor Page | Anti FAM76A pAb (ATL-HPA077897) |