Anti FAM69C pAb (ATL-HPA048928 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048928-25

• 

Protein Description: family with sequence similarity 69, member C
Gene Name: FAM69C
Alternative Gene Name: C18orf51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047992: 94%, ENSRNOG00000015448: 94%
Entrez Gene ID: 125704
Uniprot ID: Q0P6D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTGDEDCNFFDCF
• Gene Sequence: LSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTGDEDCNFFDCF
• Gene ID - Mouse: ENSMUSG00000047992
• Gene ID - Rat: ENSRNOG00000015448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.