Anti FAM58A pAb (ATL-HPA050137)

Atlas Antibodies

SKU: ATL-HPA050137-25

• 

Protein Description: family with sequence similarity 58, member A
Gene Name: FAM58A
Alternative Gene Name: FLJ21610, MGC29729
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049489: 95%, ENSRNOG00000022582: 95%
Entrez Gene ID: 92002
Uniprot ID: Q8N1B3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTE
• Gene Sequence: GVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTE
• Gene ID - Mouse: ENSMUSG00000049489
• Gene ID - Rat: ENSRNOG00000022582
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.