Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA058138-25

• 

Product Description

Protein Description: family with sequence similarity 53, member A
Gene Name: FAM53A
Alternative Gene Name: DNTNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037339: 55%, ENSRNOG00000017548: 56%
Entrez Gene ID: 152877
Uniprot ID: Q6NSI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCDSRGLPGITMPGCSQRGLRTSPVHPNLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN
• Gene Sequence: PCDSRGLPGITMPGCSQRGLRTSPVHPNLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN
• Gene ID - Mouse: ENSMUSG00000037339
• Gene ID - Rat: ENSRNOG00000017548
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links