Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA058138-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: family with sequence similarity 53, member A
Gene Name: FAM53A
Alternative Gene Name: DNTNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037339: 55%, ENSRNOG00000017548: 56%
Entrez Gene ID: 152877
Uniprot ID: Q6NSI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM53A
Alternative Gene Name: DNTNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037339: 55%, ENSRNOG00000017548: 56%
Entrez Gene ID: 152877
Uniprot ID: Q6NSI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PCDSRGLPGITMPGCSQRGLRTSPVHPNLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN |
Gene Sequence | PCDSRGLPGITMPGCSQRGLRTSPVHPNLWASRESVTSDGSRRSSGDPRDGDSVGEEGVFPRARWELDLEQIENN |
Gene ID - Mouse | ENSMUSG00000037339 |
Gene ID - Rat | ENSRNOG00000017548 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation) | |
Datasheet | Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation) | |
Datasheet | Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FAM53A pAb (ATL-HPA058138 w/enhanced validation) |