Anti FAM49A pAb (ATL-HPA060398)

Atlas Antibodies

SKU: ATL-HPA060398-25

• 

Protein Description: family with sequence similarity 49, member A
Gene Name: FAM49A
Alternative Gene Name: DKFZP566A1524, FLJ11080
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020589: 98%, ENSRNOG00000052758: 98%
Entrez Gene ID: 81553
Uniprot ID: Q9H0Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEREIWNQISAVLQDSESILADLQAYKGAGPEIRDAIQNPNDIQ
• Gene Sequence: GEREIWNQISAVLQDSESILADLQAYKGAGPEIRDAIQNPNDIQ
• Gene ID - Mouse: ENSMUSG00000020589
• Gene ID - Rat: ENSRNOG00000052758
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.