Anti FAM47E pAb (ATL-HPA053331)

Atlas Antibodies

SKU:
ATL-HPA053331-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 47, member E
Gene Name: FAM47E
Alternative Gene Name: FLJ42946, LOC100129583
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078315: 38%, ENSRNOG00000003836: 38%
Entrez Gene ID: 100129583
Uniprot ID: Q6ZV65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHKMDLLHENGPRPGLHENVCKAVSDFCKWVTTFGISDIDEEFILKQFDIDYETKPSHDALHTMKLNQVPLELKRSVGLSK
Gene Sequence PHKMDLLHENGPRPGLHENVCKAVSDFCKWVTTFGISDIDEEFILKQFDIDYETKPSHDALHTMKLNQVPLELKRSVGLSK
Gene ID - Mouse ENSMUSG00000078315
Gene ID - Rat ENSRNOG00000003836
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM47E pAb (ATL-HPA053331)
Datasheet Anti FAM47E pAb (ATL-HPA053331) Datasheet (External Link)
Vendor Page Anti FAM47E pAb (ATL-HPA053331) at Atlas Antibodies

Documents & Links for Anti FAM47E pAb (ATL-HPA053331)
Datasheet Anti FAM47E pAb (ATL-HPA053331) Datasheet (External Link)
Vendor Page Anti FAM47E pAb (ATL-HPA053331)