Anti FAM47B pAb (ATL-HPA050996)

Atlas Antibodies

SKU: ATL-HPA050996-25

• 

Protein Description: family with sequence similarity 47, member B
Gene Name: FAM47B
Alternative Gene Name: FLJ35782
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026211: 31%, ENSRNOG00000009891: 30%
Entrez Gene ID: 170062
Uniprot ID: Q8NA70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARARCEGQEMTTEELTKPGKYHFWESCPRPFESRMPHLRLVLPITRRMASLCLKPPKTRR
• Gene Sequence: ARARCEGQEMTTEELTKPGKYHFWESCPRPFESRMPHLRLVLPITRRMASLCLKPPKTRR
• Gene ID - Mouse: ENSMUSG00000026211
• Gene ID - Rat: ENSRNOG00000009891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.