Anti FAM46C pAb (ATL-HPA054049)

Atlas Antibodies

SKU: ATL-HPA054049-25

• 
• 

Protein Description: family with sequence similarity 46, member C
Gene Name: FAM46C
Alternative Gene Name: FLJ20202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044468: 87%, ENSRNOG00000015222: 85%
Entrez Gene ID: 54855
Uniprot ID: Q5VWP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRG
• Gene Sequence: MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRG
• Gene ID - Mouse: ENSMUSG00000044468
• Gene ID - Rat: ENSRNOG00000015222
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.