Anti FAM43B pAb (ATL-HPA050813)

Atlas Antibodies

SKU: ATL-HPA050813-25

• 
• 

Protein Description: family with sequence similarity 43, member B
Gene Name: FAM43B
Alternative Gene Name: FLJ44952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078235: 99%, ENSRNOG00000043113: 99%
Entrez Gene ID: 163933
Uniprot ID: Q6ZT52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY
• Gene Sequence: PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY
• Gene ID - Mouse: ENSMUSG00000078235
• Gene ID - Rat: ENSRNOG00000043113
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.