Anti FAM43B pAb (ATL-HPA050813)
Atlas Antibodies
- SKU:
- ATL-HPA050813-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FAM43B
Alternative Gene Name: FLJ44952
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078235: 99%, ENSRNOG00000043113: 99%
Entrez Gene ID: 163933
Uniprot ID: Q6ZT52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY |
Gene Sequence | PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY |
Gene ID - Mouse | ENSMUSG00000078235 |
Gene ID - Rat | ENSRNOG00000043113 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM43B pAb (ATL-HPA050813) | |
Datasheet | Anti FAM43B pAb (ATL-HPA050813) Datasheet (External Link) |
Vendor Page | Anti FAM43B pAb (ATL-HPA050813) at Atlas Antibodies |
Documents & Links for Anti FAM43B pAb (ATL-HPA050813) | |
Datasheet | Anti FAM43B pAb (ATL-HPA050813) Datasheet (External Link) |
Vendor Page | Anti FAM43B pAb (ATL-HPA050813) |