Anti FAM43A pAb (ATL-HPA048345)

Atlas Antibodies

SKU: ATL-HPA048345-25

• 
• 

Protein Description: family with sequence similarity 43, member A
Gene Name: FAM43A
Alternative Gene Name: FLJ90022
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046546: 76%, ENSRNOG00000052587: 78%
Entrez Gene ID: 131583
Uniprot ID: Q8N2R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDMKAELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP
• Gene Sequence: SDMKAELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSRQADGASADEP
• Gene ID - Mouse: ENSMUSG00000046546
• Gene ID - Rat: ENSRNOG00000052587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.