Anti FAM3C pAb (ATL-HPA050548 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050548-25

• 
• 
• 

Protein Description: family with sequence similarity 3, member C
Gene Name: FAM3C
Alternative Gene Name: GS3876, ILEI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029672: 89%, ENSRNOG00000060349: 88%
Entrez Gene ID: 10447
Uniprot ID: Q92520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCG
• Gene Sequence: KTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCG
• Gene ID - Mouse: ENSMUSG00000029672
• Gene ID - Rat: ENSRNOG00000060349
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM3C pAb (ATL-HPA050548 w/enhanced validation) – 1 Found

Shi, Mengyue; Duan, Guihua; Nie, Shuang; Shen, Shanshan; Zou, Xiaoping. Elevated FAM3C promotes cell epithelial- mesenchymal transition and cell migration in gastric cancer. Oncotargets And Therapy. 11( 30584315):8491-8505.