Anti FAM32A pAb (ATL-HPA051712)

Atlas Antibodies

SKU: ATL-HPA051712-25

• 
• 
• 

Protein Description: family with sequence similarity 32, member A
Gene Name: FAM32A
Alternative Gene Name: DKFZP586O0120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003039: 98%, ENSRNOG00000039528: 98%
Entrez Gene ID: 26017
Uniprot ID: Q9Y421
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
• Gene Sequence: RLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
• Gene ID - Mouse: ENSMUSG00000003039
• Gene ID - Rat: ENSRNOG00000039528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.