Anti FAM24B pAb (ATL-HPA052490)

Atlas Antibodies

SKU:
ATL-HPA052490-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 24, member B
Gene Name: FAM24B
Alternative Gene Name: AC073585.2, MGC45962
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030858: 52%, ENSRNOG00000026419: 39%
Entrez Gene ID: 196792
Uniprot ID: Q8N5W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TESCPALQCCEGYRMCASFDSLPPCCCDINEGL
Gene Sequence TESCPALQCCEGYRMCASFDSLPPCCCDINEGL
Gene ID - Mouse ENSMUSG00000030858
Gene ID - Rat ENSRNOG00000026419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM24B pAb (ATL-HPA052490)
Datasheet Anti FAM24B pAb (ATL-HPA052490) Datasheet (External Link)
Vendor Page Anti FAM24B pAb (ATL-HPA052490) at Atlas Antibodies

Documents & Links for Anti FAM24B pAb (ATL-HPA052490)
Datasheet Anti FAM24B pAb (ATL-HPA052490) Datasheet (External Link)
Vendor Page Anti FAM24B pAb (ATL-HPA052490)