Anti FAM228B pAb (ATL-HPA052598)
Atlas Antibodies
- SKU:
- ATL-HPA052598-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FAM228B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024073: 27%, ENSRNOG00000015249: 28%
Entrez Gene ID: 375190
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDLKPLARAPYLLESQEEEKTVIYKNKGSSFLEREPLCYQEGNNPSAKEAISEGYFSSLSLSRNGRKTRMGLP |
Gene Sequence | FDLKPLARAPYLLESQEEEKTVIYKNKGSSFLEREPLCYQEGNNPSAKEAISEGYFSSLSLSRNGRKTRMGLP |
Gene ID - Mouse | ENSMUSG00000024073 |
Gene ID - Rat | ENSRNOG00000015249 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM228B pAb (ATL-HPA052598) | |
Datasheet | Anti FAM228B pAb (ATL-HPA052598) Datasheet (External Link) |
Vendor Page | Anti FAM228B pAb (ATL-HPA052598) at Atlas Antibodies |
Documents & Links for Anti FAM228B pAb (ATL-HPA052598) | |
Datasheet | Anti FAM228B pAb (ATL-HPA052598) Datasheet (External Link) |
Vendor Page | Anti FAM228B pAb (ATL-HPA052598) |