Anti-FAM228A pAb (ATL-HPA075817)
Atlas Antibodies
- SKU:
- ATL-HPA075817-100
- Shipping:
- Calculated at Checkout
$596.00
Product Description
Polyclonal Antibody against Human FAM228A, Gene description: family with sequence similarity 228 member A, Alternative Gene Names: C2orf84, FLJ30851, Validated applications: ICC, Uniprot ID: Q86W67, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE |
Gene Sequence | FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE |
Gene ID - Mouse | ENSMUSG00000079177 |
Gene ID - Rat | ENSRNOG00000050114 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti-FAM228A pAb (ATL-HPA075817) | |
Vendor Page | Anti-FAM228A pAb (ATL-HPA075817) at Atlas Antibodies |
Documents & Links for Anti-FAM228A pAb (ATL-HPA075817) | |
Vendor Page | Anti-FAM228A pAb (ATL-HPA075817) |