Anti FAM227B pAb (ATL-HPA049774)

Atlas Antibodies

SKU:
ATL-HPA049774-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 227, member B
Gene Name: FAM227B
Alternative Gene Name: C15orf33, FLJ32800
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027209: 54%, ENSRNOG00000037124: 50%
Entrez Gene ID: 196951
Uniprot ID: Q96M60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVLFNFGGQSPLILYYLKMHELAGISKAPKKTKIKLTKIFQEPLPAPTYRDVIKEAKRQFARNQKDFRILQAKATKKPHEVKQD
Gene Sequence RVLFNFGGQSPLILYYLKMHELAGISKAPKKTKIKLTKIFQEPLPAPTYRDVIKEAKRQFARNQKDFRILQAKATKKPHEVKQD
Gene ID - Mouse ENSMUSG00000027209
Gene ID - Rat ENSRNOG00000037124
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM227B pAb (ATL-HPA049774)
Datasheet Anti FAM227B pAb (ATL-HPA049774) Datasheet (External Link)
Vendor Page Anti FAM227B pAb (ATL-HPA049774) at Atlas Antibodies

Documents & Links for Anti FAM227B pAb (ATL-HPA049774)
Datasheet Anti FAM227B pAb (ATL-HPA049774) Datasheet (External Link)
Vendor Page Anti FAM227B pAb (ATL-HPA049774)