Anti FAM222B pAb (ATL-HPA051840)

Atlas Antibodies

SKU: ATL-HPA051840-25

• 
• 
• 

Protein Description: family with sequence similarity 222, member B
Gene Name: FAM222B
Alternative Gene Name: C17orf63, FLJ10700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037750: 99%, ENSRNOG00000029570: 99%
Entrez Gene ID: 55731
Uniprot ID: Q8WU58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SILKDFDGTRARLLPEAIMNPPVAPYATVAPSTLAHPQAQALARQQALQHAQTLAHAPPQTLQHPQGIPPPQALSHPQS
• Gene Sequence: SILKDFDGTRARLLPEAIMNPPVAPYATVAPSTLAHPQAQALARQQALQHAQTLAHAPPQTLQHPQGIPPPQALSHPQS
• Gene ID - Mouse: ENSMUSG00000037750
• Gene ID - Rat: ENSRNOG00000029570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.