Protein Description: family with sequence similarity 20, member A
Gene Name: FAM20A
Alternative Gene Name: DKFZp434F2322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020614: 96%, ENSRNOG00000003969: 94%
Entrez Gene ID: 54757
Uniprot ID: Q96MK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM20A
Alternative Gene Name: DKFZp434F2322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020614: 96%, ENSRNOG00000003969: 94%
Entrez Gene ID: 54757
Uniprot ID: Q96MK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRH |
Documents & Links for Anti FAM20A pAb (ATL-HPA048964) | |
Datasheet | Anti FAM20A pAb (ATL-HPA048964) Datasheet (External Link) |
Vendor Page | Anti FAM20A pAb (ATL-HPA048964) at Atlas |
Documents & Links for Anti FAM20A pAb (ATL-HPA048964) | |
Datasheet | Anti FAM20A pAb (ATL-HPA048964) Datasheet (External Link) |
Vendor Page | Anti FAM20A pAb (ATL-HPA048964) |