Anti FAM20A pAb (ATL-HPA048964)

Atlas Antibodies

SKU: ATL-HPA048964-25

• 

Protein Description: family with sequence similarity 20, member A
Gene Name: FAM20A
Alternative Gene Name: DKFZp434F2322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020614: 96%, ENSRNOG00000003969: 94%
Entrez Gene ID: 54757
Uniprot ID: Q96MK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRH
• Gene Sequence: RHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRH
• Gene ID - Mouse: ENSMUSG00000020614
• Gene ID - Rat: ENSRNOG00000003969
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.