Anti FAM204A pAb (ATL-HPA062025)
Atlas Antibodies
- SKU:
- ATL-HPA062025-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: family with sequence similarity 204, member A
Gene Name: FAM204A
Alternative Gene Name: bA319I23.1, C10orf84, FLJ13188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057858: 88%, ENSRNOG00000009830: 88%
Entrez Gene ID: 63877
Uniprot ID: Q9H8W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM204A
Alternative Gene Name: bA319I23.1, C10orf84, FLJ13188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057858: 88%, ENSRNOG00000009830: 88%
Entrez Gene ID: 63877
Uniprot ID: Q9H8W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QWKELTQYFGVNDRFDPPVKRKKVEKSGLEKRIDQAVEEWNIEKAEELSNQL |
| Gene Sequence | QWKELTQYFGVNDRFDPPVKRKKVEKSGLEKRIDQAVEEWNIEKAEELSNQL |
| Gene ID - Mouse | ENSMUSG00000057858 |
| Gene ID - Rat | ENSRNOG00000009830 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti FAM204A pAb (ATL-HPA062025) | |
| Datasheet | Anti FAM204A pAb (ATL-HPA062025) Datasheet (External Link) |
| Vendor Page | Anti FAM204A pAb (ATL-HPA062025) at Atlas Antibodies |
| Documents & Links for Anti FAM204A pAb (ATL-HPA062025) | |
| Datasheet | Anti FAM204A pAb (ATL-HPA062025) Datasheet (External Link) |
| Vendor Page | Anti FAM204A pAb (ATL-HPA062025) |