Anti FAM198A pAb (ATL-HPA047726)

Atlas Antibodies

SKU: ATL-HPA047726-25

• 
• 

Protein Description: family with sequence similarity 198, member A
Gene Name: FAM198A
Alternative Gene Name: C3orf41, DKFZP434B172
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038233: 46%, ENSRNOG00000025676: 45%
Entrez Gene ID: 729085
Uniprot ID: Q9UFP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSGLTLWPHTAEGRDLLGAENRALTGGQQAEDPTLASGAHQWPGSVEKLQGSVWCDAETLLSSSRTGGQAPPWLTDHDVQMLR
• Gene Sequence: TSGLTLWPHTAEGRDLLGAENRALTGGQQAEDPTLASGAHQWPGSVEKLQGSVWCDAETLLSSSRTGGQAPPWLTDHDVQMLR
• Gene ID - Mouse: ENSMUSG00000038233
• Gene ID - Rat: ENSRNOG00000025676
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.