Anti FAM196B pAb (ATL-HPA047227)

Atlas Antibodies

SKU:
ATL-HPA047227-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 196, member B
Gene Name: FAM196B
Alternative Gene Name: C5orf57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069911: 84%, ENSRNOG00000032329: 87%
Entrez Gene ID: 100131897
Uniprot ID: A6NMK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGN
Gene Sequence AEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGN
Gene ID - Mouse ENSMUSG00000069911
Gene ID - Rat ENSRNOG00000032329
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM196B pAb (ATL-HPA047227)
Datasheet Anti FAM196B pAb (ATL-HPA047227) Datasheet (External Link)
Vendor Page Anti FAM196B pAb (ATL-HPA047227) at Atlas Antibodies

Documents & Links for Anti FAM196B pAb (ATL-HPA047227)
Datasheet Anti FAM196B pAb (ATL-HPA047227) Datasheet (External Link)
Vendor Page Anti FAM196B pAb (ATL-HPA047227)