Anti FAM192A pAb (ATL-HPA059652)

Atlas Antibodies

SKU: ATL-HPA059652-25

• 

Protein Description: family with sequence similarity 192, member A
Gene Name: FAM192A
Alternative Gene Name: C16orf94, NIP30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031774: 86%, ENSRNOG00000017841: 84%
Entrez Gene ID: 80011
Uniprot ID: Q9GZU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSD
• Gene Sequence: KRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSD
• Gene ID - Mouse: ENSMUSG00000031774
• Gene ID - Rat: ENSRNOG00000017841
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.