Anti FAM186A pAb (ATL-HPA047128)

Atlas Antibodies

SKU: ATL-HPA047128-25

• 

Protein Description: family with sequence similarity 186, member A
Gene Name: FAM186A
Alternative Gene Name: LOC121006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045350: 37%, ENSRNOG00000024073: 27%
Entrez Gene ID: 121006
Uniprot ID: A6NE01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETVTKILRKYKDTKKEEQVGEKPIKQKKVVSFMPGLHFQKSPISAKSESSTLLSYESTDPVINNLIQMILAEIESERDIPTVSTVQKDHKEK
• Gene Sequence: ETVTKILRKYKDTKKEEQVGEKPIKQKKVVSFMPGLHFQKSPISAKSESSTLLSYESTDPVINNLIQMILAEIESERDIPTVSTVQKDHKEK
• Gene ID - Mouse: ENSMUSG00000045350
• Gene ID - Rat: ENSRNOG00000024073
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.