Anti FAM182B pAb (ATL-HPA050100)

Atlas Antibodies

SKU: ATL-HPA050100-25

• 
• 

Protein Description: family with sequence similarity 182, member B
Gene Name: FAM182B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022095: 33%, ENSRNOG00000020363: 32%
Entrez Gene ID: 728882
Uniprot ID: Q5T319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRKI
• Gene Sequence: WGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRKI
• Gene ID - Mouse: ENSMUSG00000022095
• Gene ID - Rat: ENSRNOG00000020363
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.