Anti FAM173A pAb (ATL-HPA046262 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046262-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-FAM173A antibody. Corresponding FAM173A RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 173, member A
Gene Name: FAM173A
Alternative Gene Name: C16orf24, MGC2494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057411: 74%, ENSRNOG00000019684: 77%
Entrez Gene ID: 65990
Uniprot ID: Q9BQD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAA
Gene Sequence CAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAA
Gene ID - Mouse ENSMUSG00000057411
Gene ID - Rat ENSRNOG00000019684
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM173A pAb (ATL-HPA046262 w/enhanced validation)
Datasheet Anti FAM173A pAb (ATL-HPA046262 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM173A pAb (ATL-HPA046262 w/enhanced validation)