Anti FAM171A1 pAb (ATL-HPA051345)

Atlas Antibodies

SKU:
ATL-HPA051345-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 171, member A1
Gene Name: FAM171A1
Alternative Gene Name: C10orf38, FLJ12884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050530: 84%, ENSRNOG00000016534: 79%
Entrez Gene ID: 221061
Uniprot ID: Q5VUB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDR
Gene Sequence LGKDYHKSVEVFPLKARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQEHLYPAPSSPEKEQLLDR
Gene ID - Mouse ENSMUSG00000050530
Gene ID - Rat ENSRNOG00000016534
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM171A1 pAb (ATL-HPA051345)
Datasheet Anti FAM171A1 pAb (ATL-HPA051345) Datasheet (External Link)
Vendor Page Anti FAM171A1 pAb (ATL-HPA051345) at Atlas Antibodies

Documents & Links for Anti FAM171A1 pAb (ATL-HPA051345)
Datasheet Anti FAM171A1 pAb (ATL-HPA051345) Datasheet (External Link)
Vendor Page Anti FAM171A1 pAb (ATL-HPA051345)