Protein Description: family with sequence similarity 163, member B
Gene Name: FAM163B
Alternative Gene Name: C9orf166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009216: 86%, ENSRNOG00000006591: 85%
Entrez Gene ID: 642968
Uniprot ID: P0C2L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM163B
Alternative Gene Name: C9orf166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009216: 86%, ENSRNOG00000006591: 85%
Entrez Gene ID: 642968
Uniprot ID: P0C2L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQE |
Documents & Links for Anti FAM163B pAb (ATL-HPA067336) | |
Datasheet | Anti FAM163B pAb (ATL-HPA067336) Datasheet (External Link) |
Vendor Page | Anti FAM163B pAb (ATL-HPA067336) at Atlas |
Documents & Links for Anti FAM163B pAb (ATL-HPA067336) | |
Datasheet | Anti FAM163B pAb (ATL-HPA067336) Datasheet (External Link) |
Vendor Page | Anti FAM163B pAb (ATL-HPA067336) |