Anti FAM160A1 pAb (ATL-HPA046348 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046348-25

• 
• 

Protein Description: family with sequence similarity 160, member A1
Gene Name: FAM160A1
Alternative Gene Name: FLJ43373
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051000: 96%, ENSRNOG00000048256: 96%
Entrez Gene ID: 729830
Uniprot ID: Q05DH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFS
• Gene Sequence: LLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFS
• Gene ID - Mouse: ENSMUSG00000051000
• Gene ID - Rat: ENSRNOG00000048256
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.