Anti FAM156A pAb (ATL-HPA056640)

Atlas Antibodies

SKU: ATL-HPA056640-25

• 
• 

Protein Description: family with sequence similarity 156, member A
Gene Name: FAM156A
Alternative Gene Name: PRO0659, TMEM29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041353: 49%, ENSRNOG00000048516: 48%
Entrez Gene ID: 29057
Uniprot ID: Q8NDB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPEGLLRQRYREEKTLEE
• Gene Sequence: MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPEGLLRQRYREEKTLEE
• Gene ID - Mouse: ENSMUSG00000041353
• Gene ID - Rat: ENSRNOG00000048516
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.