Anti FAM133B pAb (ATL-HPA069513)

Atlas Antibodies

SKU: ATL-HPA069513-25

• 

Protein Description: family with sequence similarity 133, member B
Gene Name: FAM133B
Alternative Gene Name: MGC40405
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058503: 100%, ENSRNOG00000009163: 100%
Entrez Gene ID: 257415
Uniprot ID: Q5BKY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMARSRGPIQSSGPTIQDYLNRPRPTWEEV
• Gene Sequence: AMARSRGPIQSSGPTIQDYLNRPRPTWEEV
• Gene ID - Mouse: ENSMUSG00000058503
• Gene ID - Rat: ENSRNOG00000009163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.