Anti FAM124B pAb (ATL-HPA070240)

Atlas Antibodies

SKU: ATL-HPA070240-25

• 
• 

Product Description

Protein Description: family with sequence similarity 124B
Gene Name: FAM124B
Alternative Gene Name: FLJ22746
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043230: 73%, ENSRNOG00000054416: 76%
Entrez Gene ID: 79843
Uniprot ID: Q9H5Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQ
• Gene Sequence: MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQ
• Gene ID - Mouse: ENSMUSG00000043230
• Gene ID - Rat: ENSRNOG00000054416
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links