Protein Description: family with sequence similarity 124B
Gene Name: FAM124B
Alternative Gene Name: FLJ22746
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043230: 73%, ENSRNOG00000054416: 76%
Entrez Gene ID: 79843
Uniprot ID: Q9H5Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM124B
Alternative Gene Name: FLJ22746
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043230: 73%, ENSRNOG00000054416: 76%
Entrez Gene ID: 79843
Uniprot ID: Q9H5Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQ |
| Documents & Links for Anti FAM124B pAb (ATL-HPA070240) | |
| Datasheet | Anti FAM124B pAb (ATL-HPA070240) Datasheet (External Link) |
| Vendor Page | Anti FAM124B pAb (ATL-HPA070240) at Atlas |
| Documents & Links for Anti FAM124B pAb (ATL-HPA070240) | |
| Datasheet | Anti FAM124B pAb (ATL-HPA070240) Datasheet (External Link) |
| Vendor Page | Anti FAM124B pAb (ATL-HPA070240) |