Anti FAM124A pAb (ATL-HPA048182)

Atlas Antibodies

SKU: ATL-HPA048182-25

• 
• 

Protein Description: family with sequence similarity 124A
Gene Name: FAM124A
Alternative Gene Name: FLJ30707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035184: 68%, ENSRNOG00000009802: 70%
Entrez Gene ID: 220108
Uniprot ID: Q86V42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QWFSNTGAPGHRASEWRHGHLLSIDDLEGAQETDVDTGLRLSSSDLSVVSAYSAPSRFCSTVETPLPSERCSSHWAAHKDSREGPLPTVSRV
• Gene Sequence: QWFSNTGAPGHRASEWRHGHLLSIDDLEGAQETDVDTGLRLSSSDLSVVSAYSAPSRFCSTVETPLPSERCSSHWAAHKDSREGPLPTVSRV
• Gene ID - Mouse: ENSMUSG00000035184
• Gene ID - Rat: ENSRNOG00000009802
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.