Anti FAM106A pAb (ATL-HPA056425)

Atlas Antibodies

SKU:
ATL-HPA056425-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 106, member A
Gene Name: FAM106A
Alternative Gene Name: FLJ11800
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032497: 24%, ENSRNOG00000053814: 25%
Entrez Gene ID: 80039
Uniprot ID: Q4KMX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLHVCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKELPLRNLLECRFFDCMGEEDLINLGVIGTER
Gene Sequence SLHVCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKELPLRNLLECRFFDCMGEEDLINLGVIGTER
Gene ID - Mouse ENSMUSG00000032497
Gene ID - Rat ENSRNOG00000053814
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM106A pAb (ATL-HPA056425)
Datasheet Anti FAM106A pAb (ATL-HPA056425) Datasheet (External Link)
Vendor Page Anti FAM106A pAb (ATL-HPA056425) at Atlas Antibodies

Documents & Links for Anti FAM106A pAb (ATL-HPA056425)
Datasheet Anti FAM106A pAb (ATL-HPA056425) Datasheet (External Link)
Vendor Page Anti FAM106A pAb (ATL-HPA056425)