Anti FAIM pAb (ATL-HPA052209)

Atlas Antibodies

SKU:
ATL-HPA052209-100
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in human cell line HEK 293.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: Fas apoptotic inhibitory molecule
Gene Name: FAIM
Alternative Gene Name: FAIM1, FLJ10582
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032463: 88%, ENSRNOG00000030069: 86%
Entrez Gene ID: 55179
Uniprot ID: Q9NVQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS
Gene Sequence KDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS
Gene ID - Mouse ENSMUSG00000032463
Gene ID - Rat ENSRNOG00000030069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAIM pAb (ATL-HPA052209)
Datasheet Anti FAIM pAb (ATL-HPA052209) Datasheet (External Link)
Vendor Page Anti FAIM pAb (ATL-HPA052209) at Atlas Antibodies

Documents & Links for Anti FAIM pAb (ATL-HPA052209)
Datasheet Anti FAIM pAb (ATL-HPA052209) Datasheet (External Link)
Vendor Page Anti FAIM pAb (ATL-HPA052209)