Anti FAHD2A pAb (ATL-HPA044987)

Atlas Antibodies

SKU:
ATL-HPA044987-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: fumarylacetoacetate hydrolase domain containing 2A
Gene Name: FAHD2A
Alternative Gene Name: CGI-105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027371: 80%, ENSRNOG00000013974: 73%
Entrez Gene ID: 51011
Uniprot ID: Q96GK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLP
Gene Sequence KWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLP
Gene ID - Mouse ENSMUSG00000027371
Gene ID - Rat ENSRNOG00000013974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAHD2A pAb (ATL-HPA044987)
Datasheet Anti FAHD2A pAb (ATL-HPA044987) Datasheet (External Link)
Vendor Page Anti FAHD2A pAb (ATL-HPA044987) at Atlas Antibodies

Documents & Links for Anti FAHD2A pAb (ATL-HPA044987)
Datasheet Anti FAHD2A pAb (ATL-HPA044987) Datasheet (External Link)
Vendor Page Anti FAHD2A pAb (ATL-HPA044987)