Protein Description: Fas associated factor family member 2
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 99%, ENSRNOG00000017607: 98%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 99%, ENSRNOG00000017607: 98%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEV |
Documents & Links for Anti FAF2 pAb (ATL-HPA065968) | |
Datasheet | Anti FAF2 pAb (ATL-HPA065968) Datasheet (External Link) |
Vendor Page | Anti FAF2 pAb (ATL-HPA065968) at Atlas |
Documents & Links for Anti FAF2 pAb (ATL-HPA065968) | |
Datasheet | Anti FAF2 pAb (ATL-HPA065968) Datasheet (External Link) |
Vendor Page | Anti FAF2 pAb (ATL-HPA065968) |