Anti FADS3 pAb (ATL-HPA045224)
Atlas Antibodies
- SKU:
- ATL-HPA045224-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FADS3
Alternative Gene Name: CYB5RP, LLCDL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024664: 92%, ENSRNOG00000020385: 90%
Entrez Gene ID: 3995
Uniprot ID: Q9Y5Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED |
Gene Sequence | PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED |
Gene ID - Mouse | ENSMUSG00000024664 |
Gene ID - Rat | ENSRNOG00000020385 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FADS3 pAb (ATL-HPA045224) | |
Datasheet | Anti FADS3 pAb (ATL-HPA045224) Datasheet (External Link) |
Vendor Page | Anti FADS3 pAb (ATL-HPA045224) at Atlas Antibodies |
Documents & Links for Anti FADS3 pAb (ATL-HPA045224) | |
Datasheet | Anti FADS3 pAb (ATL-HPA045224) Datasheet (External Link) |
Vendor Page | Anti FADS3 pAb (ATL-HPA045224) |