Anti FA2H pAb (ATL-HPA056614)

Atlas Antibodies

SKU: ATL-HPA056614-25

• 

Protein Description: fatty acid 2-hydroxylase
Gene Name: FA2H
Alternative Gene Name: FAAH, FAXDC1, FLJ25287, SPG35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033579: 92%, ENSRNOG00000018950: 95%
Entrez Gene ID: 79152
Uniprot ID: Q7L5A8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS
• Gene Sequence: LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS
• Gene ID - Mouse: ENSMUSG00000033579
• Gene ID - Rat: ENSRNOG00000018950
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.