Anti F3 pAb (ATL-HPA049292)

Atlas Antibodies

SKU:
ATL-HPA049292-25
  • Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: coagulation factor III (thromboplastin, tissue factor)
Gene Name: F3
Alternative Gene Name: CD142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028128: 55%, ENSRNOG00000011800: 54%
Entrez Gene ID: 2152
Uniprot ID: P13726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN
Gene Sequence VKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGEN
Gene ID - Mouse ENSMUSG00000028128
Gene ID - Rat ENSRNOG00000011800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti F3 pAb (ATL-HPA049292)
Datasheet Anti F3 pAb (ATL-HPA049292) Datasheet (External Link)
Vendor Page Anti F3 pAb (ATL-HPA049292) at Atlas Antibodies

Documents & Links for Anti F3 pAb (ATL-HPA049292)
Datasheet Anti F3 pAb (ATL-HPA049292) Datasheet (External Link)
Vendor Page Anti F3 pAb (ATL-HPA049292)



Citations for Anti F3 pAb (ATL-HPA049292) – 3 Found
Vessby, Johan; Lampinen, Maria; Åberg, Mikael; Rorsman, Fredrik; Siegbahn, Agneta; Wanders, Alkwin; Carlson, Marie. Tissue factor in ulcerative colitis, with and without concomitant primary sclerosing cholangitis. Upsala Journal Of Medical Sciences. 2019;124(4):238-245.  PubMed
Rosell, Axel; Moser, Bernhard; Hisada, Yohei; Chinthapatla, Rukesh; Lian, Grace; Yang, Yi; Flick, Matthew J; Mackman, Nigel. Evaluation of different commercial antibodies for their ability to detect human and mouse tissue factor by western blotting. Research And Practice In Thrombosis And Haemostasis. 2020;4(6):1013-1023.  PubMed
Fawkner-Corbett, David; Antanaviciute, Agne; Parikh, Kaushal; Jagielowicz, Marta; Gerós, Ana Sousa; Gupta, Tarun; Ashley, Neil; Khamis, Doran; Fowler, Darren; Morrissey, Edward; Cunningham, Chris; Johnson, Paul R V; Koohy, Hashem; Simmons, Alison. Spatiotemporal analysis of human intestinal development at single-cell resolution. Cell. 2021;184(3):810-826.e23.  PubMed